PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna02324.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 555aa    MW: 60669 Da    PI: 6.3824
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna02324.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.88e-16101148148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              +grWT+eEd+ l+++++  G g+W++ ++  g+ R++k+c++rw +yl
  mrna02324.1-v1.0-hybrid 101 KGRWTAEEDQTLINYIRANGEGSWRSLPKNAGLLRCGKSCRLRWINYL 148
                              79******************************99************97 PP

2Myb_DNA-binding51.22.8e-16154199148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg+ T++E+++++++++ lG++ W++Ia+ ++ gRt++++k++w+++l
  mrna02324.1-v1.0-hybrid 154 RGNITPQEEDIIIKLHASLGNR-WSLIASQLP-GRTDNEIKNYWNSHL 199
                              7999******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-2192151IPR009057Homeodomain-like
PROSITE profilePS5129416.58396148IPR017930Myb domain
SuperFamilySSF466899.56E-2898195IPR009057Homeodomain-like
SMARTSM007178.7E-12100150IPR001005SANT/Myb domain
PfamPF002492.7E-14101148IPR001005SANT/Myb domain
CDDcd001679.27E-9103148No hitNo description
PROSITE profilePS5129425.801149203IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.0E-25152203IPR009057Homeodomain-like
SMARTSM007173.4E-16153201IPR001005SANT/Myb domain
PfamPF002491.0E-14154199IPR001005SANT/Myb domain
CDDcd001671.21E-10158199No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 555 aa     Download sequence    Send to blast
MKEKSICPIN KGAGLAKAHS LRYIWQLRAC TAEGGIRSEV ETERGGRARR RDDWMSRVRA  60
LRTYMDVGNA KPHHEPLDNG EATTLTEMGR APCCEKVGLK KGRWTAEEDQ TLINYIRANG  120
EGSWRSLPKN AGLLRCGKSC RLRWINYLRA DLKRGNITPQ EEDIIIKLHA SLGNRWSLIA  180
SQLPGRTDNE IKNYWNSHLS RKIDAFRRPI NKIHMPSASA AAAASSSSST TTAADEINMA  240
MKLGPPSSKR RGRGGRTSRW AMKKNKVTYA STAINHHLDS CTHNHDDKSA TMTSSSSPPP  300
PSAAAAAVAA GTGQKETQAL VGGGPSDGSA AGKFDDGGEV AFNDLMMDVA NEIISDPTGV  360
LTLIGEKQND DGDDDTGVIR DDEDTGKLLC GPNKVMTNAT AAASHEEEHH QLDQISATNL  420
SSSSNSNSKS SYGEAEAAAF DGDDWYNSCS NYSPGSAAAA TCKFDQQKQQ RDGINGTVND  480
EMTWDWESDI HRYDYLWNVD QKDDENMLSW LWEQHAADDH HLDHSNKSRS KAVVVDDDCD  540
PADKHNAILA WLLS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-24992045109B-MYB
1h8a_C7e-249920325128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00627PBMTransfer from PK06182.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744701e-113DQ074470.1 Malus x domestica MYB22 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004301809.10.0PREDICTED: transcription factor MYB12-like
TrEMBLQ2LME21e-98Q2LME2_MALDO; MYB22
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62610.13e-69myb domain protein 11